For Research Use Only. Not for human use.
Ultra Pure Peptides – Research Use Only – Raw Material Sourced from the USA
$98.00
Vasoactive Intestinal Peptide (VIP) is a 28-amino acid neuropeptide initially discovered in the small intestine but now known to be distributed widely throughout the nervous, immune, cardiovascular, and endocrine systems. It plays a vital role in regulating smooth muscle activity, vasodilation, neurotransmission, circadian rhythms, immune modulation, and pulmonary and gastrointestinal health. Due to its broad activity, VIP is being explored for use in respiratory, autoimmune, neurological, and metabolic conditions.
20 in stock
Vasoactive Intestinal Peptide buy is a 28-amino acid polypeptide that functions as a neurotransmitter and hormone.
The primary component of human VIP is a sequence of 28 amino acids:
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn
Viral entry: Research indicates that VIP downregulates the ACE2 and the TMPRESS2 for expression of the epithelial cells, and hampering the SARSCOV2 entry.
Immune modulation: The VIP has investigated its capacity for reducing the respiratory failure and mortality in covid19 by suppressing the release of Pro inflammatory cytokines ofr enhancing regulatory T cells.
Rheumatoid Arthritis (RA): Research focuses how the VIP’s can inhibit the synovial fibroblast and proliferation as it promotes the expansion and reduces bone cartilage.
Various researches into the alzheimer and parkinson can highlight the vasoactive intestinal peptide as the neuroprotective factor that can inhibit the microglia activation.
Stabilized Analogues: Many native VIPs can have a short half life, as its significant portion of its research highly focuses on developing stable VIP analogy and novel delivery system for improving efficacy in targeted tissues.
The VIP shifts in teh immune response from the proinflammatory to the anti inflammatory proifels as it reduces the porduction of cytokines and suppresses the T cell proliferation while promoting T cells.
The vip vasoactive intestinal peptide can relax smooth muscle in airways, and blood vessels. It acts as a brochodilator. This also mediated by the Camp and in some tissues nitric oxide dependent pathways.
It enhances the survival and mesenchymal stem cells and potects teh eipthelial barrier by reducing the apoptosis.
It stimulates water adn electrolyte secretion in the intestinal tract.
Study focus: Role of VIP in gut health
Findings: VIP-deficient mice had disrupted microbiota diversity and weight loss
Study focus: VPAC2 receptor knockout models
Findings: Reduced fat mass, increased insulin sensitivity, and higher metabolism in VIP signaling-deficient mice
Study focus: Inhaled VIP (Aviptadil) in COPD patients
Findings: Improved exercise capacity (6-minute walk test) after 6 months
Study focus: VIP infusion in healthy subjects
Findings: Induced migraine attacks in 71% of participants vs. 5% in placebo group
The research centres can directly order it from the SunGod Lab’s platform. The bulk orders, handling instructions or batch verification reports are also available on request to ensure further seamless integration into laboratory workflows.
Sequence:HSDAVFTDNYTLDQITYTKPESFNSSEIKR
Molecular Formula:C152H252N44O47S2
Molecular Weight:3,300 Da
Epithalon by SunGod Labs is a synthetic tetrapeptide known for its profound anti-ageing and longevity-enhancing properties. It activates telomerase, extends telomere length, improves sleep, modulates the immune system, and reduces oxidative stress. With a strong history of research in Russia and Europe, Epithalon is considered one of the most effective peptides for delaying biological ageing and improving overall health span.
| Quantity | 25mg |
|---|
PT-141, by SunGod Labs also known as Bremelanotide, is a synthetic peptide developed as a melanocortin receptor agonist for the treatment of sexual dysfunction in both men and women. Unlike drugs that act on vascular pathways, PT-141 targets the central nervous system to enhance sexual desire and arousal, making it a novel option for individuals with low libido who may not respond to traditional hormone or PDE5-based therapies.
| Quantity | 10mg |
|---|
Melanotan 2 by SunGod Labs is a synthetic melanocortin peptide known for stimulating melanin production in the skin, leading to enhanced tanning with minimal sun exposure. It also exhibits secondary effects such as increased libido, appetite suppression, and fat metabolism. Due to its interaction with multiple melanocortin receptors, MT2 has therapeutic potential for erectile dysfunction, skin protection, and metabolic regulation.
| Quantity | 10mg |
|---|
AOD-9604 (5mg) is a specialized fat-burning peptide, offering targeted fat loss without the side effects commonly associated with growth hormone (GH) therapy. Its ability to mimic HGH’s fat-burning capabilities without impacting glucose metabolism makes it a safe and effective option for long-term weight management and body recomposition. SunGod Labs AOD-9604 peptides are used in laboratories worldwide for research purposes.
| Quantity | 5mg, 10mg, 50mg |
|---|