Vasoactive Intestinal Peptide (VIP) (6mg)

$98.00

Vasoactive Intestinal Peptide (VIP) is a 28-amino acid neuropeptide initially discovered in the small intestine but now known to be distributed widely throughout the nervous, immune, cardiovascular, and endocrine systems. It plays a vital role in regulating smooth muscle activity, vasodilation, neurotransmission, circadian rhythms, immune modulation, and pulmonary and gastrointestinal health. Due to its broad activity, VIP is being explored for use in respiratory, autoimmune, neurological, and metabolic conditions.

20 in stock

Components of the Vasoactive Intestinal Peptide (VIP) (6mg)

Vasoactive Intestinal Peptide is a 28-amino acid polypeptide that functions as a neurotransmitter and hormone.

Amino Acid Sequence

The primary component of human VIP is a sequence of 28 amino acids:

His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn

Current Research Focus Of Vasoactive Intestinal Peptide (VIP) (6mg)

1. Acute Respiratory Distress Syndrome (ARDS)

Viral entry: Research indicates that VIP downregulates the ACE2 and TMPRESS2 for expression in the epithelial cells, and hampers the SARSCOV2 entry.

Immune Modulation: The VIP has investigated its capacity for reducing the respiratory failure and mortality in covid19 by suppressing the release of pro-inflammatory cytokines and enhancing regulatory T cells.

2. Autoimmune and Chronic Inflammatory Diseases

Rheumatoid Arthritis (RA): Research focuses on how the VIP’s can inhibit the synovial fibroblast and proliferation, as it promotes the expansion and reduces bone cartilage.

3. Neuroprotection and Neurodegenerative Disorders

Various research into Alzheimer’s and Parkinson’s can highlight the vasoactive intestinal peptide as the neuroprotective factor that can inhibit microglia activation.

4. Therapeutic Delivery and Stability

Stabilized Analogues: Many native VIPs can have a short half-life, as a significant portion of their research highly focuses on developing stable VIP analogues and novel delivery systems for improving efficacy in targeted tissues.

Immunomodulation:

The VIP shifts in the immune response from the proinflammatory to the anti-inflammatory profiles, as it reduces the production of cytokines and suppresses the T cell proliferation while promoting T cells.

Vasodilation and Smooth Muscle Relaxation:

The vip vasoactive intestinal peptide can relax smooth muscle in airways and blood vessels. It acts as a bronchodilator. This is also mediated by the Camp and, in some tissues, nitric oxide-dependent pathways.

Cytoprotection and Tissue Repair:

It enhances the survival of mesenchymal stem cells and protects the epithelial barrier by reducing apoptosis.

Secretagogue Activity:

It stimulates water and electrolyte secretion in the intestinal tract.

1. Gut Microbiota and Metabolic Balance

Study focus: Role of VIP in gut health

Findings: VIP-deficient mice had disrupted microbiota diversity and weight loss

2. Growth and Metabolic Regulation

Study focus: VPAC2 receptor knockout models

Findings: Reduced fat mass, increased insulin sensitivity, and higher metabolism in VIP signalling-deficient mice

3. Pulmonary Function (COPD Therapy)

Study focus: Inhaled VIP (Aviptadil) in COPD patients

Findings: Improved exercise capacity (6-minute walk test) after 6 months

4. Migraine Induction

Study focus: VIP infusion in healthy subjects

Findings: Induced migraine attacks in 71% of participants vs. 5% in the placebo group

References

Note : Please review and adhere to our Terms and Conditions before ordering

Molecular Structure

Sequence:HSDAVFTDNYTLDQITYTKPESFNSSEIKR

Molecular Formula:C152H252N44O47S2

Molecular Weight:3,300 Da

TRENDING PEPTIDES

PT-141 (10mg) By SunGod labs

PT-141, also known as Bremelanotide, is a synthetic peptide developed as a melanocortin receptor agonist for the treatment of sexual dysfunction in both men and women. Unlike drugs that act on vascular pathways, PT-141 targets the central nervous system to enhance sexual desire and arousal, making it a novel option for individuals with low libido who may not respond to traditional hormone or PDE5-based therapies.

Additional information

Quantity

10mg

N Acetyl Selank (10mg) By SunGod Labs

N Acetyl Selank (10mg) is a synthetic peptide derived from Selank, which itself is an analogue of the human tuftsin peptide. This acetylated version is designed for enhanced stability and potency, offering nootropic, anxiolytic, and neuroprotective benefits. It modulates key neurotransmitters like serotonin, dopamine, and GABA, and has been researched for its effects on anxiety reduction, mood stabilization, cognitive enhancement, and immune regulation.

Additional information

Quantity

10mg

KISSPEPTIN (10mg) By SunGod Labs

Kisspeptin is a neuropeptide hormone that plays a central role in the regulation of the reproductive hormone axis. It acts as a master regulator of gonadotropin-releasing hormone (GnRH) by binding to the KISS1 receptor (GPR54) in the hypothalamus. This triggers the release of GnRH, which subsequently stimulates the secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH), governing sex hormone production and reproductive function. Kisspeptin is increasingly recognized for its therapeutic potential in fertility, puberty regulation, and hormone restoration.

Additional information

Quantity

10mg

ARA-290 (16mg) By SunGod Labs

ARA 290 is a non-erythropoietic peptide that offers neuroprotection, pain relief, anti-inflammation, and tissue repair, especially for neuropathy.

Additional information

Quantity

16mg